| Desktop | 95/100 | ✔ |
| Mobile | 86/100 | ✔ |
| Field | Data | Result |
|---|---|---|
| Page Size | 9 KB | ✔ |
| Compression | 3 KB (-63.6%) | ✔ |
| Text/Html Ratio | 77 / 9518 (bytes) = 0.81% | ✘ |
| Load Time | 0.96 second | ✔ |
| Mobile Ready | 0/100 | ✘ |
| In-Page Links | 2 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | English | ✔ |
| Preferred Domain | No | ❗ |
| Robots.txt | Yes | ✔ |
| Url Rewrite | Yes | ✘ |
| Underscores in url | No | ✔ | Images Without ALT | 0 / 0 | ✔ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | No | ✔ |
| Iframe | No | ✔ |
| Custom 404 page | Yes | ✔ |
| Email Privacy | Yes | ✔ |
| Gsafe browsing | Yes | ✔ |
| Analytics | No | ✘ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| privacy | 1 | ✘ | ✘ | ✘ |
| terms | 1 | ✘ | ✘ | ✘ |
| ofuse | 1 | ✘ | ✘ | ✘ |
|
With 0.96 seconds in page load, 9 KB of page size and all other reports below, the medmalpracticelawyersearchfinds.info has a SEO score of 63 out of 100 |
| Title | Personal Injury Lawyer Medical Malpractice |
| Description | Personal Injury Lawyer Medical Malpractice,Injured During Surgery Lawyer,Surgery Injury Lawyer,Hospital Injury Attorneys,A Lawyer For Medical Malpractice,Medical Malpractice Attorney |
| Keyword |
| Age | 0 Years, 3 Days |
| Created | 3rd-Jun-2020 |
| Updated | 3rd-Jun-2020 |
| Expiry | 3rd-Jun-2021 |
| Host | Type | Ttl | Other |
|---|---|---|---|
|
Domain Name: MEDMALPRACTICELAWYERSEARCHFINDS.INFO Registry Domain ID: D503300001185621628-LRMS Registrar WHOIS Server: whois.godaddy.com Registrar URL: http://www.godaddy.com Updated Date: 2020-06-03T19:54:33Z Creation Date: 2020-06-03T19:54:32Z Registry Expiry Date: 2021-06-03T19:54:32Z Registrar Registration Expiration Date: Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email: abuse@godaddy.com Registrar Abuse Contact Phone: +1.4806242505 Reseller: Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Domain Status: serverTransferProhibited https://icann.org/epp#serverTransferProhibited Domain Status: addPeriod https://icann.org/epp#addPeriod Registrant Organization: Domains By Proxy, LLC Registrant State/Province: Arizona Registrant Country: US Name Server: NS1.DNSPARKER.COM Name Server: NS2.DNSPARKER.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form is https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2020-06-06T17:02:45Z |
| Server IP | 18.216.20.136 |
| Server Location | United States |
| Service Provider | Amazon.com |
| Domains (TLD) | Status |
|---|---|
| medmalpracticelawyersearchfinds.com | Available |
| medmalpracticelawyersearchfinds.net | Available |
| medmalpracticelawyersearchfinds.org | Available |
| medmalpracticelawyersearchfinds.biz | Already Registered |
| medmalpracticelawyersearchfinds.io | Already Registered |
| Domains (TLD) | Status |
|---|---|
| nedmalpracticelawyersearchfinds.info | Available |
| hedmalpracticelawyersearchfinds.info | Available |
| jedmalpracticelawyersearchfinds.info | Available |
| kedmalpracticelawyersearchfinds.info | Available |
| ledmalpracticelawyersearchfinds.info | Available |
| Wayside.digital |
| Eelamnaturalfoods.info |
| Allyourbestgifts.com |
| Clarvazatoareajulia.com |
| Cheesynightin.com |
| Thebestnursingshoesreview.com |
| Leewmillerrealtor.com |
| Sgdiscover.com |
| Labelcook.net |
| Hasbors.com |